PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00012634001
Common NameGSBRNA2T00012634001, LOC106394289
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 331aa    MW: 37443.2 Da    PI: 8.215
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00012634001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.8e-31195250156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W++eLH+rF++a+++LGGs+ AtPk+i++lm+v+gLt+++vkSHLQkYRl+
  GSBRNA2T00012634001 195 KQRRCWSSELHRRFLHALQRLGGSHAATPKQIRDLMQVDGLTNDEVKSHLQKYRLH 250
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.638192252IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27193253IPR009057Homeodomain-like
SuperFamilySSF466892.57E-17193253IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-27195250IPR006447Myb domain, plants
PfamPF002497.9E-7197248IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAKKGDNMDY TLKKKRCEEY IEALEEEQKK IQVFKRELPL CLSLVTQAIE SYWKELSEFS  60
RSEHIQSEGS ERTTSEFEGR DGCIALSEEF VPIKSCERVK DDEAENNVDK KKSEWLQLWN  120
QSPDPQPIED QTTTVVAAEV NENCGAFQPF QKGKLAYSQP LKAITPTPKA SSSTAETGGN  180
KKEMEQQKQL QMHRKQRRCW SSELHRRFLH ALQRLGGSHA ATPKQIRDLM QVDGLTNDEV  240
KSHLQKYRLH TRRPATPTLT NGCESPQQQQ LIVVEGIWVP SKDGVNNRVY APVAVQPPPR  300
SSPSEPRSIQ RCKPPTASSS THPSHLLPLS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00012634001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894761e-118AC189476.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB080N15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013690324.10.0PREDICTED: probable transcription factor GLK1
TrEMBLA0A078G6E30.0A0A078G6E3_BRANA; BnaC07g11890D protein
STRINGBra012471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-119G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]